PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA4G00338
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 254aa    MW: 28068.4 Da    PI: 8.3183
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA4G00338genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.1e-19651147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde+l ++v ++G ++W+ I++ ++ gR++k+c++rw + 
        AA4G00338  6 KGPWSPEEDEQLRRLVMKYGARNWTVISKSIP-GRSGKSCRLRWCNQ 51
                     79******************************.***********985 PP

2Myb_DNA-binding54.82.2e-1760102347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +++ +Ede +++a++q+G++ W+tIar ++ gRt++ +k++w++ 
        AA4G00338  60 PFSSQEDETIIRAHAQFGNK-WATIARLLN-GRTDNAVKNHWNST 102
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.771156IPR017930Myb domain
SuperFamilySSF466891.72E-31399IPR009057Homeodomain-like
SMARTSM007171.4E-17554IPR001005SANT/Myb domain
PfamPF002494.5E-19651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-25759IPR009057Homeodomain-like
CDDcd001675.52E-17850No hitNo description
SMARTSM007173.5E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129419.86958107IPR017930Myb domain
CDDcd001672.58E-1160103No hitNo description
PfamPF002492.9E-1460102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2260106IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000031Biological Processregulation of salicylic acid mediated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MADRIKGPWS PEEDEQLRRL VMKYGARNWT VISKSIPGRS GKSCRLRWCN QLSPQVEHRP  60
FSSQEDETII RAHAQFGNKW ATIARLLNGR TDNAVKNHWN STLKRKSNNT SFDESPLKRA  120
KSVNGPIDGP IGLYIGPESP NGSDVSDYSS TIPLFKPVPR SGGVAVLQTT SCGGGDDDPA  180
TSLSLSLPGS ETSEESNRSN EWGNCNTVSF LPFSVGGEFL EVVKEMIKVE VRSYMEEMQK  240
EKGLNNGGFR VSMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3911082109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00596DAPTransfer from AT5G67300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279745.11e-114hypothetical protein CARUB_v10027659mg
SwissprotQ9FDW11e-109MYB44_ARATH; Transcription factor MYB44
TrEMBLR0GN941e-114R0GN94_9BRAS; Uncharacterized protein
STRINGscaffold_803378.11e-112(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-103myb domain protein r1